Dermorphin
Dermorphin RM126.08 RM244.02Price range: RM126.08 through RM244.02
Back to products
Asetic Acid water
Asetic Acid water RM40.67 RM56.94Price range: RM40.67 through RM56.94

FOXO4-DRI

RM333.49 RM1,179.43Price range: RM333.49 through RM1,179.43

Sales Count 111 units

FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide designed to disrupt the interaction between the FOXO4 transcription factor and p53, a key regulator of apoptosis. This disruption allows p53 to induce apoptosis in senescent cells, which are cells that have stopped dividing and contribute to aging and various diseases. The peptide has shown promise in selectively targeting and eliminating senescent cells, thereby restoring tissue homeostasis and offering potential therapeutic benefits in several conditions.

Peptide Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids)
Molecular Formula: C228H388N86O64
Molecular Weight: 5358 g/mol
Synonyms: Forkhead box protein 04, Proxofim, FOXO4a, AFX, AFX1, MLLT7, FOXO 4-DRI, EX-A7431