Asetic Acid water
Asetic Acid water £7.49 £10.49Price range: £7.49 through £10.49
Back to products
Adamax
Adamax £52.43 £74.90Price range: £52.43 through £74.90

LL37

£60.67

Sales Count 66 units

1000 in stock

LL-37 is a multifunctional cationic antimicrobial peptide that forms part of the human innate immune defence system. As the only cathelicidin-derived peptide found in humans, LL-37 plays a central role in antimicrobial defence, immune regulation, and tissue repair.

Comprising 37 amino acids, LL-37 is produced primarily by neutrophils, macrophages, and epithelial cells, and is expressed in various tissues including the skin, lungs, and gastrointestinal tract. Researchers value LL-37 for its broad biological activity, making it a key focus in studies relating to immunity, inflammation, and cellular repair mechanisms.

Synonyms: Cathelicidin, Antibacterial Protein LL-37, GTPL5527
Amino Acid Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
IUPAC Condensed Sequence: H–Leu–Leu–Gly–Asp–Phe–Phe–Arg–Lys–Ser–Lys–Glu–Lys–Ile–Gly–Lys–Glu–Phe–Lys–Arg–Ile–Val–Gln–Arg–Ile–Lys–Asp–Phe–Leu–Arg–Asn–Leu–Val–ProG–H
Molecular Weight: 4493.34 g/mol